| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MTPEMKELASKLEDTTQSLYDLALVIYNLEDTTPPDTIPENISTLINHLRSLPKISKKVNEPISQDVLEYVEQGRNPDVYARQFSELVQKDNQYVHGKFLAMENFQQTLAEEIISAYPHLKNDVDDILAQGSK |
| Length | 133 |
| Position | Middle |
| Organism | Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) (Fission yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina> Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae> Schizosaccharomyces. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.538 |
| Instability index | 36.35 |
| Isoelectric point | 4.61 |
| Molecular weight | 15178.89 |
| Publications | PubMed=21511999 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP32576 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) ISTLI 2) LYDLALVIYNLEDTT | 42 19 | 46 33 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab