Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSSILLEPLGQLQDLSQQLFLSLGPPQSKPPPAPPVSAFLEVDAVLADAVQRARAHQVRQRRIEALKADILELEDEWRGVVESLEEGRRELEGIVKEGEERLKAIEDAKKAAIPYPELLAYAQSLSAFTSAPPNMPDLALPGQPPPPLFFPPFPNEEKMRRGHMNDEAPLGLLGETHSVGKAPTVQPRSVEHPDHLLGPGANPYRPDLRAPQQQFFDLDLDLNPDL |
Length | 226 |
Position | Middle |
Organism | Fomitopsis pinicola (strain FP-58527) (Brown rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Fomitopsis. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.462 |
Instability index | 63.30 |
Isoelectric point | 4.82 |
Molecular weight | 24938.04 |
Publications | PubMed=22745431 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32562 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.00| 13| 114| 23| 35| 1 --------------------------------------------------------------------------- 23- 35 (29.10/10.78) LGPPQSKPPPA..PP 138- 152 (23.91/ 7.64) LALPGQPPPPLffPP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LLEPLG 2) QFFDLDLDLN 3) QLFLSL 4) YRPDLR | 5 214 18 204 | 10 223 23 209 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab