| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSSILLEPLGQLQDLSQQLFLSLGPPQSKPPPAPPVSAFLEVDAVLADAVQRARAHQVRQRRIEALKADILELEDEWRGVVESLEEGRRELEGIVKEGEERLKAIEDAKKAAIPYPELLAYAQSLSAFTSAPPNMPDLALPGQPPPPLFFPPFPNEEKMRRGHMNDEAPLGLLGETHSVGKAPTVQPRSVEHPDHLLGPGANPYRPDLRAPQQQFFDLDLDLNPDL |
| Length | 226 |
| Position | Middle |
| Organism | Fomitopsis pinicola (strain FP-58527) (Brown rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Fomitopsis. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.462 |
| Instability index | 63.30 |
| Isoelectric point | 4.82 |
| Molecular weight | 24938.04 |
| Publications | PubMed=22745431 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP32562
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.00| 13| 114| 23| 35| 1
---------------------------------------------------------------------------
23- 35 (29.10/10.78) LGPPQSKPPPA..PP
138- 152 (23.91/ 7.64) LALPGQPPPPLffPP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) LLEPLG 2) QFFDLDLDLN 3) QLFLSL 4) YRPDLR | 5 214 18 204 | 10 223 23 209 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab