<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32558
| Description |
Uncharacterized protein |
| Sequence | MATDFWFSSQHCRWSVDRTTLRDARAEDLQYVGHPEHLDFLSMFFSGLIGRLGKKLTLKQRVIATATVFFRRFYVKNAYCDTDPFIVIAACCYVAAKAEESPVHIKNVVTEARSLFSKYGIKTFPADNSKLAEMEFYLVDDLECDLTVFHPYRTLMTLCSKEGSDVSEAEAGEVGVGIDDGPRYWGTGEGRLEMHEGALQMAWFLINDTYRSDLCLLYPPHLIAITAIYMACAVHQETRGDIEKQTQSQPHGLAGSTGAPPSMRRSSRPSSSSFKRQQPQDIVGFLAGLNVNMGLVGTIAQEIVALHALWDRYNDDGTVSDSRASLKRSVSGAIVGGATPSVSSSPIGTPVVSGDHGHGEQRPEIVRPGFLIQLFWRMREARMNDLSGAHAGPSRAVAVNKVLERAQAAG |
| Length | 410 |
| Position | Kinase |
| Organism | Fomitopsis pinicola (strain FP-58527) (Brown rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Fomitopsis.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.186 |
| Instability index | 47.48 |
| Isoelectric point | 6.36 |
| Molecular weight | 45112.68 |
| Publications | PubMed=22745431
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32558
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.92| 31| 82| 258| 289| 1
---------------------------------------------------------------------------
258- 289 (54.36/35.67) GAPPSMRRS..SRPSSS...SFKRQQPqDIV..GFLAGL
337- 374 (42.56/23.18) GATPSVSSSpiGTPVVSgdhGHGEQRP.EIVrpGFLIQL
---------------------------------------------------------------------------
|