<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32557
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGFTGLVRWTNAPSTGVELIRHNITVNHQGILRGRWQVGLSSWRSRFTGESSDMRSLERPLYTVTMNENTFVMLEDPGAPNRGDFLKMKAAHEQGQAVQPFVPQPPPHYHYTLVTVSPLGALEQLMSHLGVVGKRWVRTGGGQGSGHHLSVDGLIYSIGNDWLVRFGHVMLAGGSKGMLIEAEYLPLPDLHTEGGEGRSELLSDFLASVIPLLPDSEIWTVAVSDEMWAEVLAGLEEEDVEEEAENKADEDNDDIFISSDFLPAARKTDWLGVNRDKRSAYLIQGALKGEALI |
Length | 293 |
Position | Head |
Organism | Fomitopsis pinicola (strain FP-58527) (Brown rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Fomitopsis.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.256 |
Instability index | 52.63 |
Isoelectric point | 4.94 |
Molecular weight | 32330.07 |
Publications | PubMed=22745431
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32557
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.14| 21| 24| 132| 155| 1
---------------------------------------------------------------------------
132- 155 (34.65/26.05) VGKRW.VRTGGGQGSGhhlSVDGLI
158- 179 (32.49/16.41) IGNDWlVRFGHVMLAG...GSKGML
---------------------------------------------------------------------------
|