<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32545
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADEQQRNTASAFPAPPPFYTHFTPENQARLKDIQSASTSNPSEDDGGDSSGADKDAPAQAQTLPPELACLIPPKPPTQGQYRSFGDTWNIPDRLPTLKELNIPQLFPEPSGESYNVDRAQELRRLSKSLLLNYLELVGIMGVSPEEAAANLTIGGGMQFEEKVYHMRIHLINIHQLINEYRPHQARETLISMMEEQLERSKQETEENRKACRKIRELMAGLDSFNANGLLSTTPEETGEGVGAGEGAGGEASKENDRKDSASWEALQQAGLA |
| Length | 273 |
| Position | Middle |
| Organism | Dactylellina haptotyla (strain CBS 200.50) (Nematode-trapping fungus) (Monacrosporium haptotylum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Orbiliomycetes>
Orbiliales> Orbiliaceae> Dactylellina.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.736 |
| Instability index | 54.88 |
| Isoelectric point | 4.78 |
| Molecular weight | 30016.97 |
| Publications | PubMed=24244185
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060
ECO:0000256 ARBA:ARBA00003669
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32545
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.58| 15| 23| 86| 101| 1
---------------------------------------------------------------------------
86- 101 (23.39/16.28) GDTWNIpDRLPTLKEL
112- 126 (24.19/11.53) GESYNV.DRAQELRRL
---------------------------------------------------------------------------
|