Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MESSPIVVGGLDPSQSQQPSSQPSIQFSPSDRIKQLNQIDKEITSLLTTASEAITTLSSPKPSQTTFKAQSTSYHASVQSIITSLKRQIYALEQADIPLPAILTSSSGSSAPAAGSAAAGGLDIGALSGRSDSVGRKMEKELWQKAREMIEAGPSEEGEKLDLRMDVEVGDTS |
Length | 173 |
Position | Head |
Organism | Dactylellina haptotyla (strain CBS 200.50) (Nematode-trapping fungus) (Monacrosporium haptotylum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Orbiliomycetes> Orbiliales> Orbiliaceae> Dactylellina. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.384 |
Instability index | 69.51 |
Isoelectric point | 4.81 |
Molecular weight | 18207.08 |
Publications | PubMed=24244185 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32526 No repeats found |
MoRF Sequence | Start | Stop |
1) DIPLPAI 2) EKLDLRMDVEVG 3) LDIGAL 4) VGRKMEKELWQKAREMIEAGPSE | 96 159 122 134 | 102 170 127 156 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab