<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32520

Description Uncharacterized protein
SequenceMADILTQLQTCLDQLATQFYATLGYLNTYHDNSPATPPPGISNAAPALAKMSKNTTAPPVPASIANSAGAGAAAAGAAQSPVPPPTQQPGAESGAGEGEETNALPRPDSPRTFAARQRELARDLIIKEQQIEYLISVLPGIGASEKEQETRIRELEAQLREVEKERTAKATELKQLRTRLENVLGAVSTGIYGDREQ
Length197
PositionMiddle
OrganismPenicillium oxalicum (strain 114-2 / CGMCC 5302) (Penicillium decumbens)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.04
Grand average of hydropathy-0.491
Instability index54.15
Isoelectric point5.06
Molecular weight20930.17
Publications
PubMed=23383313

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32520
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      76.88|      15|      20|      35|      49|       1
---------------------------------------------------------------------------
   35-   49 (27.87/12.41)	ATP.PPGISNAAPALA
   57-   72 (22.92/ 9.06)	APPvPASIANSAGAGA
   82-   95 (26.09/11.20)	V.P.PPTQQPGAESGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      99.11|      33|      40|     111|     143|       2
---------------------------------------------------------------------------
  111-  143 (52.93/38.01)	RTFAARQRELARDLIIKEQQIEYLISVLPGI.GA
  153-  186 (46.18/32.31)	RELEAQLREVEKERTAKATELKQLRTRLENVlGA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32520 with Med21 domain of Kingdom Fungi
Unable to open file!