<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32515
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MSQESPAQQMFTSADRIRQLNDIDKDISQLLQSAGLAIQALTNNQPDSNGSMNGSLDSHKAQFKEAVSKYFALLSSVDVRLRRQIYALEEDSLGQELAGKPGDPNGAGVGAAGSIGAGSGAVNLLDISWLNSRKDTVGMDKEAELWAAARGFVEHLARAPNGDSRPKESLGSDEMQVD |
| Length | 178 |
| Position | Head |
| Organism | Penicillium oxalicum (strain 114-2 / CGMCC 5302) (Penicillium decumbens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.483 |
| Instability index | 35.64 |
| Isoelectric point | 4.76 |
| Molecular weight | 18960.75 |
| Publications | PubMed=23383313
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32515
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.76| 20| 55| 39| 58| 1
---------------------------------------------------------------------------
39- 58 (35.95/18.86) QALTNNQPDSNGSMNGSLDS
95- 114 (35.81/18.76) QELAGKPGDPNGAGVGAAGS
---------------------------------------------------------------------------
|