<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32504

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMSEVYSQFLQAVRERLIDDIAEASKSTSDARPVKRFKRGFLLGPPSSPSEWGSGWEHYAQCRPLIHCHLHLHLSPSRLIIKPLLTPTPFHPLPFYLPSPPGTPITLLPYGTPAYLLSSYTGPTSVLTSQFTDSLAGLGTGDWASPPPYTSTNSAPGKGPMYVIAWVGVQNKQGEDKGLPLIWPARLCVAFHPAAQCARKPLAYLPALPPELQASPVPPPPPDAPAVQVQAQGNKPIRPSLKRSSVFTARAGETQAAFKCMTLVAGGKDMPAVAAEASAYVEAVARERERERERLKRERESAHASSPMRSAPPMTPTPMTLSTPAAVGQTPVAAEETPIFPPSSSPAGESPMVVEQELGMVVPLPSASLVPEMTPMDMDVTLAPSTSPAVQPADTLPAPSASASVSPNPDPDPDPISFDTFTTFEPSWAQPSSADFMGYGFGDGEPAEPFDVFTEDDFNFFDRPSAGDAGLLNISPPAFGEGMRGFAAASPVKTQSSPWPVLGMGMGAGDTPAPPPELDPSSPAGTPSAYSDPPTPTVQLAAPAHASQLLLGVPRVFDPIPFAPAHKASDDKYAMGKFAVGEAQRDGKEMAVWQGKEGGWKFRYSAVTDPRVGVVRQLIGVKRKSIEQGMRDMKLSPPWIQEPEDWFPCTPDEPEEDKSEPESEEEDRWMDDDDESRSVSRPSTPLPPYLPLGPTLLHTQFHHSQLLPASSALRPPDAPAALAPAAAPPMSVPTPVSPAAALSAASEKSKSLEAAALMFAKEQIENPVWAQACRVKRMDEERASGPATEVWQSDAHQALRLLAKLEGCPPSMEVRELLASDAGSDTTGSESAVLRRLKPPLMTVTKSDAVIQTGYTALRFWEKLGLSPRNGKKDVSAFVFFEDEGDSKVQQVESWLTKVSSRYKARNLGCHVAGKAAECTRDGIVPLKLESIRKTLVNFVASLAVDTSNIVFYVVTPASIMALSSPVLRQIFSATKRTLKSHTEKQILFHLVPEHLVFASAYATSRDSPTDILVHSVYDRILRPVDRYTARPQVEQLEPRRAYVQEPAFVAARALHNSALFLREGHLRTLDVADRHTLLHVGYRISECGKWLLATCVDQRGEGYDVGVWLYPEDRKEEQVVDRVWGFACQMARRASVDWRVVVTKLGFMAEDELQVWISRLRVAVADSLDVSLHASVMVAEQGNSWTFLAPERKQSKPISPQRHASKDTHGTTFLDASWTAYTLNPPGIYTFPLTPPTLDYSYDVSCVPELTGDSADTDIGALPALSSTLVYVPAGTDHTSISMLNYLTRTRYAM
Length1294
PositionKinase
OrganismGloeophyllum trabeum (strain ATCC 11539 / FP-39264 / Madison 617) (Brown rot fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Gloeophyllales> Gloeophyllaceae> Gloeophyllum.
Aromaticity0.08
Grand average of hydropathy-0.284
Instability index56.08
Isoelectric point5.57
Molecular weight140517.80
Publications
PubMed=22745431

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32504
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     736.28|     119|     120|      82|     200|       2
---------------------------------------------------------------------------
   82-  191 (193.00/53.07)	.............................PLLTP.TPFHPLPFYLPSPPGTP.ITLL.................PYGTPAYLLSSYTGPTSVLTSQFTDSLAGLGTGDWAS..P.PPYTSTN....SAP...GKGPMYVIAWVGVQNK........QGEDKGLPLIWPARLCVAFH
  192-  297 (119.98/30.67)	PAAQCARKP................laylPALPPeLQASPVP...PPPPDAPaVQVQ.................AQGNKP..IRPSLKRSSVFTAR.....AGETQAAFKC..M.TLVAGGK....DMPavaAEASAYVEAVARERER....................ERERLKRE
  298-  382 (104.83/26.02)	RESAHASSP................mrsaPPMTP.T...............P.MTL....................STPA......................AVGQTPVAAeeT.PIFPPSS....SPA...GESPMVVEQELGMVVP........LPSASLVPEMTPMDMDVTLA
  383-  483 (109.81/27.55)	PSTSPAVQP......adtlpapsasasvsPN..............PDPDPDP.ISFD.................TFTT...FEPSWAQPSS...ADFMG..YGFGDGEPAE..PfDVFTEDDfnffDRP...SAG........................DAGLLNISPPAFGEGMR
  486-  608 (116.60/29.63)	AAASPVKTQsspwpvlgmgmgagdtpappPELDP.S..........SPAGTP.S.........................AY..SDPPTPTVQLAAPAHASQLLLGVPRVFD..P.IPFAPAH....KAS..dDKYAMGKFA.VGEAQRdgkemavwQGKEGG....WKFRYSAVTD
  681-  772 (92.06/22.11)	....................................PSTPLPPYLPLGP.....TLLhtqfhhsqllpassalrPPDAPAALAPAAAPPMSVPTP..VSPAAALSA............ASEK....SKS...LEAAALMFA.....KE........QIEN...P.VW.AQAC....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.53|      12|      15|    1088|    1101|       3
---------------------------------------------------------------------------
 1088- 1101 (17.78/16.27)	GKWLLATcvDQRGE
 1106- 1117 (23.74/13.23)	GVWLYPE..DRKEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.96|      10|      15|     992|    1001|       4
---------------------------------------------------------------------------
  992- 1001 (17.99/10.83)	PEHLVFASAY
 1008- 1017 (17.97/10.81)	PTDILVHSVY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.67|      10|      15|     962|     971|       5
---------------------------------------------------------------------------
  962-  971 (17.06/12.20)	LSSPVLRQIF
  978-  987 (16.60/11.63)	LKSHTEKQIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.45|      12|     229|     655|     669|       7
---------------------------------------------------------------------------
  635-  646 (26.46/12.97)	SPPWIQEPEDWF
  658-  669 (23.00/ 7.09)	SEPESEEEDRWM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     128.71|      38|    1178|       8|      45|       8
---------------------------------------------------------------------------
    8-   45 (64.10/35.91)	FLQAVRE..RLIDDIAEASKSTSDARPVKRFKRGFLLGPP
 1187- 1226 (64.61/36.25)	FLAPERKqsKPISPQRHASKDTHGTTFLDASWTAYTLNPP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32504 with Med13 domain of Kingdom Fungi
Unable to open file!