<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32499
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDMTDLHPPDDYSHRFFIWHEWIQANGPLTAENVFDYFATSMFYDKQSNNQVLRMQTMHTGQPLLNEAEELKRFTGIEFAVVHAQPPSLFIIHKRERLSPEYVRPLAAYFIMNNRIYQSPDVYTVLSNRLLATVNALQSSLDTLRKHRPDYTPRTGFIWPIVDPSVSEDASGKRGGEEDPLAPDENANELAAGQGTPSASVKRRAANKLQNNMLMYNAMRTTAAHTAAREQAPPPITESASVPETPVTRSSATPAPVADREPQGRTLASVPAPQEVASVKGVPGAGKKKKKRMWKSYILVFVCRHSMATSYEGTSLAASAAT |
| Length | 322 |
| Position | Head |
| Organism | Gloeophyllum trabeum (strain ATCC 11539 / FP-39264 / Madison 617) (Brown rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Gloeophyllales> Gloeophyllaceae> Gloeophyllum.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.485 |
| Instability index | 51.95 |
| Isoelectric point | 8.52 |
| Molecular weight | 35743.00 |
| Publications | PubMed=22745431
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32499
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.50| 17| 18| 85| 101| 1
---------------------------------------------------------------------------
85- 101 (31.38/19.36) QP.PSLFIIHKRERLSPE
104- 121 (28.12/16.69) RPlAAYFIMNNRIYQSPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.31| 24| 25| 241| 265| 2
---------------------------------------------------------------------------
241- 265 (37.87/25.81) SVPeTPVTRSSATPAPVADREPQGR
269- 292 (39.44/22.46) SVP.APQEVASVKGVPGAGKKKKKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.17| 11| 18| 163| 176| 4
---------------------------------------------------------------------------
163- 173 (18.80/17.81) DPSVSEDASGK
184- 194 (18.36/ 6.11) DENANELAAGQ
---------------------------------------------------------------------------
|