<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32490
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MEVGRRELEKMIDEGDERIKEIEKAKEAAIPYPELLAYAQSLSAFTSAPPNMPDLTLPGQPPPPLFFPPFPNEEKMRRGRLNAEAPLGLLGETHSVGRPPTVSPTRPPDGGAHLAPGATVYRPDQRPPQQLFDLDLDLNPDL |
| Length | 142 |
| Position | Middle |
| Organism | Gloeophyllum trabeum (strain ATCC 11539 / FP-39264 / Madison 617) (Brown rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Gloeophyllales> Gloeophyllaceae> Gloeophyllum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.643 |
| Instability index | 64.46 |
| Isoelectric point | 4.83 |
| Molecular weight | 15625.57 |
| Publications | PubMed=22745431
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32490
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.08| 14| 63| 53| 66| 1
---------------------------------------------------------------------------
53- 66 (30.69/14.02) PDLTL..PGQ.PPPPLF
116- 132 (20.39/ 6.92) PGATVyrPDQrPPQQLF
---------------------------------------------------------------------------
|