<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32487
Description |
Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MLQNEGLRQVHAMLVPEQEQGTQSSEFIPHLFYSLYQIRKDPSNANQLENSTGFIRHRLKNCKSLIANNEECRNLLSKSAEEWQEHIRSREKELMVKRKMLDDLGKRLEQLKTP |
Length | 114 |
Position | Middle |
Organism | Zygosaccharomyces bailii (strain CLIB 213 / ATCC 58445 / CBS 680 / CCRC 21525 / NBRC 1098 / NCYC 1416 / NRRL Y-2227) |
Kingdom | Fungi |
Lineage | |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.916 |
Instability index | 61.47 |
Isoelectric point | 8.62 |
Molecular weight | 13449.20 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32487
No repeats found
No repeats found
|