<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32480
Description |
ZYBA0S04-06106g1_1 |
Sequence | MSGSYWPSTQRRKWQFTKESLAMERQKLWLMECKLFPQGLNIVMDSKQNGTSRVTTKNIPITQKDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHVYLSRFLLRVSVREINLYLLVTTCVYLACKVEECPQYIRTLVSESRSLWPEVVPPDPTKVTEFEFYLIEELQSYLVIYHPYSTMEQIVNVLKEEPFHLQLSAEDQQNCWSLINDSYINDAHLTYPPHIIAVACLFVTISMRAGAAKKAMQNSSTNIQGMSEADAETALKHQEIFNRFLAESQVDLEEVTDTIQELISLYDHWEKYHEPWIKFLLHTLYLRSPTSSARSS |
Length | 329 |
Position | Kinase |
Organism | Zygosaccharomyces bailii (strain CLIB 213 / ATCC 58445 / CBS 680 / CCRC 21525 / NBRC 1098 / NCYC 1416 / NRRL Y-2227) |
Kingdom | Fungi |
Lineage | |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.259 |
Instability index | 62.66 |
Isoelectric point | 6.38 |
Molecular weight | 38530.85 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32480
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.18| 16| 45| 112| 127| 1
---------------------------------------------------------------------------
87- 103 (23.23/11.63) RRlNIRQCALATAHVYL
112- 127 (27.95/15.13) VR.EINLYLLVTTCVYL
---------------------------------------------------------------------------
|