<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32479
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MRRSAVIFVEKATPGTLTEFKDMLSNSLLSFLEPWSVELRAYRCLIKNLPPDASRLMYSITFNHHDRKTILIKNKFSMITTSSPNEVPKDLLSNVSSTNNPEPFDLILTSKLSNIWSQRQVIKGEAGETFETTDTLVRAVNLFSYTGFKGLLIELTSSEERATAEEFNESVNRMRAMLEGIGVKDLKMSQELLNPSRCSYISDLAYQYTRVLEF |
| Length | 214 |
| Position | Head |
| Organism | Zygosaccharomyces bailii (strain CLIB 213 / ATCC 58445 / CBS 680 / CCRC 21525 / NBRC 1098 / NCYC 1416 / NRRL Y-2227) |
| Kingdom | Fungi |
| Lineage | |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.252 |
| Instability index | 41.20 |
| Isoelectric point | 6.19 |
| Molecular weight | 24379.63 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32479
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.57| 19| 67| 21| 39| 1
---------------------------------------------------------------------------
21- 39 (34.69/23.02) KDMLSN.SLLSFLEPWSVEL
89- 108 (29.88/18.88) KDLLSNvSSTNNPEPFDLIL
---------------------------------------------------------------------------
|