<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32476

Description BN860_08988g1_1
SequenceMSGEGLSDILSINMKLDELELKLASTNGVKESVIGTITEAQKSILPIRLKFNDFLQTMSSIDKVDSVTPEEKFKMIRSKLLELTSSMQNVSEEFTKLQPLFDTVPEYAERYGNKRYIPLETLKSSTNLGNGLASQTQLQQQQQQQSQAQAQVQSQQQSQSQQPQSQPQQLPNGNPVSSSNSIASRKPSKSNAGTPGSNMNTPSGTTMTNMTPSSKKQRKPRQPKKTSSGIGMGPASTPVMSASNFKAQTAQSPQVGTKIAGAPLNNTTQTVSSVPPTSTMNTPMNNVMSPLGGVAPGFGISQSQPPQSMPQQISQQFSQQLSQQRQQQVQQQRDHQAQAQAQAQAQAQAQAQAHAQAQAQAQARAQAQAQVQAQAQAQAHARAQAAQAQAQAQAQAQAQAQQQPQQSQQQRAMNNTITPASILSMNMASDNQQTLGNRGNRDFDPLDMNNIDFGNLNMDFI
Length461
PositionTail
OrganismZygosaccharomyces bailii (strain CLIB 213 / ATCC 58445 / CBS 680 / CCRC 21525 / NBRC 1098 / NCYC 1416 / NRRL Y-2227)
KingdomFungi
Lineage
Aromaticity0.03
Grand average of hydropathy-0.812
Instability index56.04
Isoelectric point9.69
Molecular weight49800.73
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP32476
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|      95.43|      12|      15|     338|     349|       1
---------------------------------------------------------------------------
  146-  157 (23.69/ 6.96)	SQAQAQVQSQQQ
  158-  168 (22.94/ 6.49)	SQSQ.QPQSQPQ
  335-  346 (25.19/ 7.92)	HQAQAQAQAQAQ
  367-  378 (23.61/ 6.91)	AQAQVQAQAQAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      98.34|      20|      34|     347|     366|       2
---------------------------------------------------------------------------
  313-  332 (32.08/ 8.78)	ISQQFSQQLSQQRQQQVQQQ
  347-  366 (35.93/10.79)	AQAQAQAHAQAQAQAQARAQ
  379-  395 (30.33/ 7.87)	AHARAQA.AQAQAQAQ..AQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     124.12|      33|      34|     171|     203|       3
---------------------------------------------------------------------------
  171-  202 (54.13/18.75)	............PN......GNPVSSSNSIASRKPSKSNAG...TPGSNMNTP
  203-  238 (38.79/11.52)	S.......gttmTN......MTP.SSKKQRKPRQPKKTSSGigmGPAS...TP
  241-  283 (31.19/ 7.93)	SasnfkaqtaqsPQvgtkiaGAPLNNTTQTVSSVP..........PTSTMNTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.15|      29|      34|       9|      42|       4
---------------------------------------------------------------------------
    9-   42 (35.81/42.17)	ILSINMKLDELELKLASTNGVkESVigtiTEAQK
   44-   72 (49.34/37.45)	ILPIRLKFNDFLQTMSSIDKV.DSV....TPEEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.60|      12|      16|     431|     443|       5
---------------------------------------------------------------------------
  431-  443 (18.78/15.79)	NQQTLGNRgNRDF
  449-  460 (23.82/14.41)	NNIDFGNL.NMDF
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP32476 with Med3 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) PLETLKSSTNLGNGLASQTQLQQQQQQQSQAQAQVQSQQQSQSQQPQSQPQQLPNGNPVSSSNSIASRKPSKSNAGTPGSNMNTPSGTTMTNMTPSSKKQRKPRQPKKTSSGIGMGPASTPVMSASNFKAQTAQSPQVGTKIAGAPLNNTTQTVSSVPPTSTMNTPMNNVMSPLGGVAPGFGISQSQPPQSMPQQISQQFSQQLSQQRQQQVQQQRDHQAQAQAQAQAQAQAQAQAHAQAQAQAQARAQAQAQVQAQAQAQAHARAQAAQAQAQAQAQAQAQAQQQPQQSQQQRAMNNTITPASILSMNMASDNQQTLGNRGNRDFDPLDMNNIDFGN
118
455

Molecular Recognition Features

MoRF SequenceStartStop
NANANA