<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32474
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MQPPYIQERLDSLAKVDEQLCSLLQTASQVVFTYGELKHGNHDLKPQFEQHTSEFYTTLESATSQLKKEMRLLDENIGIRLLPINVSKKALGQDDDKLLEQTKLLKEILHSQSSQ |
| Length | 115 |
| Position | Head |
| Organism | Zygosaccharomyces bailii (strain CLIB 213 / ATCC 58445 / CBS 680 / CCRC 21525 / NBRC 1098 / NCYC 1416 / NRRL Y-2227) |
| Kingdom | Fungi |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.597 |
| Instability index | 39.39 |
| Isoelectric point | 5.51 |
| Molecular weight | 13181.82 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32474
No repeats found
No repeats found
|