<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32470
Description |
BN860_17766g1_1 |
Sequence | MTDRLTQLQICLDQMMEQFCATLNYIDKNHDFEPTDEHEPKMSDRHATVAPPEEFSNTVDELSTDIILKTRQIIKLIDSLPGVDVSTEEQMHKIDTLQKELVKIEDKKIAAVRDKEKLQKEVNDVIDFFVSGIAESRQESVEQN |
Length | 144 |
Position | Middle |
Organism | Zygosaccharomyces bailii (strain CLIB 213 / ATCC 58445 / CBS 680 / CCRC 21525 / NBRC 1098 / NCYC 1416 / NRRL Y-2227) |
Kingdom | Fungi |
Lineage | |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.622 |
Instability index | 48.72 |
Isoelectric point | 4.59 |
Molecular weight | 16618.55 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32470
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.90| 12| 19| 95| 106| 1
---------------------------------------------------------------------------
95- 106 (19.32/14.96) DTLQKELVKIED
116- 127 (19.58/15.26) EKLQKEVNDVID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.10| 11| 15| 27| 37| 2
---------------------------------------------------------------------------
27- 37 (20.46/13.17) DKNHDFEPTDE
44- 54 (19.64/12.41) DRHATVAPPEE
---------------------------------------------------------------------------
|