<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32457
| Description |
Cyclin-like protein |
| Sequence | MAANYWESSQRRRWQFTREGLEDLRKKLEDEDPNLVQGYPLPQLRHLSIYFNQQVARLGKRLGVRQQAMATAQLYIRRFYTKVEIRRTNPYLVLATAVYLACKMEECPHHIRLVVSEGRTLWPDFFSNDTSKLGECEFFLISEMSSQMIVHHPYRTLTSLQGTFSLTQEESNLAWSIINDHYMTDLPLLFAPHIIALMAILLALVLRPNQTGVQSAGNAAGGLASAAHAALSSAGSLKSSNPDKANGSSRTKVQRLASWLAESNIDIEAIVDCTQEIISFYEVQEQYNEKLTREQINRFVKARSLDK |
| Length | 307 |
| Position | Kinase |
| Organism | Glarea lozoyensis (strain ATCC 20868 / MF5171) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Helotiaceae> Glarea.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.299 |
| Instability index | 60.55 |
| Isoelectric point | 8.29 |
| Molecular weight | 34940.44 |
| Publications | PubMed=23688303
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32457
No repeats found
No repeats found
|