Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDKFIDARFDRVEKALAVLIDSIANYNPSPALAEDLLTADRELSGGLLKLQDHQNNHLRILSLRAEVAALDNQIKSTIQTLANSRRDMLQTPATIFPDDNTDNLAIRDQTKHYPFTYDQLMSYARRISRNTVPGQGQTDGSEYFAQFGLTSDNVAAAAAAANGTNGVDQSMPGTAAPTPAPTTPGIAATPGPASAATPGVNGTPAPNSIAPTGAAAADTTQSVTAPTVPDLPQDLQRYVSPMVGTIFSPWPMPDLMQQGALRTLNTLSEAQYRGPPAQYTSTPPVPVRFVSLEEQEEEERQKTAREAEEREAREERQRRMEEAAAAGARHSGGGGGGYSHGGASAQPAAPRQFASALDMDDDDD |
Length | 364 |
Position | Middle |
Organism | Ophiostoma piceae (strain UAMH 11346) (Sap stain fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Ophiostoma. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.565 |
Instability index | 50.72 |
Isoelectric point | 4.71 |
Molecular weight | 38785.28 |
Publications | PubMed=23725015 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32448 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.63| 18| 22| 178| 197| 1 --------------------------------------------------------------------------- 178- 197 (28.39/16.36) TPAPTtpGIAATPGPASAAT 203- 220 (31.24/12.47) TPAPN..SIAPTGAAAADTT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 76.92| 23| 30| 50| 72| 2 --------------------------------------------------------------------------- 50- 72 (37.38/27.11) LQDHQNNHLRILSLRAEVAALDN 78- 100 (39.55/29.11) IQTLANSRRDMLQTPATIFPDDN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.45| 16| 31| 237| 253| 3 --------------------------------------------------------------------------- 237- 253 (26.81/16.61) RYVSPMVGTIFSPwPMP 271- 286 (31.65/14.79) QYRGPPAQYTSTP.PVP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GGGYSHGGASAQPAAPRQFASALDMDDDDD 2) QRRMEEAAAAGARHS | 335 317 | 364 331 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab