<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32444

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMENGSRNGLHTNHDRDQRPNGVNGANHTSEKSTEKGKGRAEPQQNVTPVSPTAPHGVNGGFMSRSRNGDEKQDLIPGDIKARMDELPPEITHIVEGHLLSLNKLLSRVAQKTHNDLERTILDLAQMPIPPSVANGAVSHLTPGEDNGKENVDKKARLLKFAQDAHTELLKALVITNWSRRSADVAKLIDLKAHLDKEKFYYELAIHELFELKKSLGQARIPNPDLKTALEVLTTGKVSWMPDLGYIQPPPLTPTEILKSLENLNTILSIRLNLDEHHKIPYHFKDYTIQNGRVTFKVKGEFEVDLTVADEDPESQFWFIDFKFLFSPSVSDLAPHLRSHIEQQVNKALAEEGLTGCYKYLHGLVLSHQISEFRRQAVALSRGTWVETLAVEPLNRALSIQYWLNRYGQKGPKSWIILGVHSGKRKTGVPHPKDTPRLFLRWFREGKEMKDVDIPFQTATVSAESLLKTVIAQHIRLILEATYDQLLKKPIYAKGGARVAVYLDNEQPSESKLTVQLTSERQVFIKIEPITGRCIVGPASRLTGLHEFKFNQDIPDADKFLHARIDELRYDAIAEYISSRSVTAGWHRLPNPGLGREDLKALVPEGTAQVLWFKRSGWTKNWHLAVSMGSTGESWWLIETTEPTPQVISHGPRKIEKKMVVKIISFIAVPIKNRSPLPTYKFLTTLHVFTAALMSHHANLKALYERRVQHMLHESRNVRSPMQLPAIFARISNLVDWKNKTTRDLVKLSFQGLESCRSAKLDGTPRHGAEASGQPNSPENNVVMITEARINIPVPDTLKTMKENIDQDIAFDSNTGMLALRLRSKIGDSVIPTLVERTIRVFRLVEFVKVLQEHSASLKCEQISLGKITFTYGTSRAAQDLDKMDEDTPSKQYTAMIDFSGSANSMSLILEKGNPHLMIADLLRSILNGKEGLGGVATLLPVTLPLLAGLDTIEMAWATVSKTKGEVFVLVRATDWYEIRYNILSASSDSNISTNLRKVTFEIKLRHRAGVPWWDIRRSDQQDPLGDDIEAVLKPVWNLSGTGFQGMRVSSVAQPHGAEEILGKIDDALRNFVLSQKPASLSPSATQKSRPQGQQLRQHQTVTPNPSQQSQGRNNQSRREVVEID
Length1124
PositionTail
OrganismGlarea lozoyensis (strain ATCC 20868 / MF5171)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Helotiaceae> Glarea.
Aromaticity0.07
Grand average of hydropathy-0.412
Instability index42.90
Isoelectric point9.10
Molecular weight126111.61
Publications
PubMed=23688303

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP32444
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     117.81|      28|     277|     760|     787|       1
---------------------------------------------------------------------------
  760-  787 (49.10/25.17)	LDG....TPRHGAEAS..GQPNSPENNVVMITEA
 1038- 1067 (40.07/19.36)	LSG....TGFQGMRVSsvAQPHGAEEILGKIDDA
 1095- 1123 (28.64/11.99)	LRQhqtvTPNPSQQSQ..GRNNQSRREVVEI...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     209.63|      64|     297|      99|     179|       2
---------------------------------------------------------------------------
   99-  165 (102.72/51.09)	LSLNKLLSRV.AQKTHNDLERTILDLAQMPIPpsvANGAVSHLTPGEDNGKENV......DKKARLLKFAQDAH
  397-  446 (72.56/28.75)	LSIQYWLNRY.GQK.......................GPKSWIILGVHSGKRKTgvphpkDTPRLFLRWFREGK
  460-  494 (34.35/21.96)	VSAESLLKTViAQHIRLILEATYDQLLKKPIY...AKG....................................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     145.19|      32|     292|     364|     395|       6
---------------------------------------------------------------------------
  364-  395 (54.75/35.04)	VLSHQISEFRRQ...AVA...L.SRG.T...W..VE....TLAVEPLNR
  563-  600 (19.40/ 7.51)	....RIDELRYD...AIAeyiS.SRS.VtagW..HRlpnpGLGREDLKA
  609-  645 (32.58/17.78)	VLWFKRSGWTKNwhlAVS...MgSTGeS...WwlIE....T..TEPTPQ
  646-  673 (38.45/22.35)	VISHGPRKIEKK...MVV.........K...I..IS....FIAVPIKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.20|      11|     571|     220|     230|       7
---------------------------------------------------------------------------
  220-  230 (21.53/14.59)	IPNPD.LKTALE
  791-  802 (17.67/10.48)	IPVPDtLKTMKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.62|      17|      34|      19|      51|       9
---------------------------------------------------------------------------
   19-   35 (31.43/38.81)	PNGVNGANHT.SEKSTEK
   54-   71 (29.20/ 6.68)	PHGVNGGFMSrSRNGDEK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32444 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MENGSRNGLHTNHDRDQRPNGVNGANHTSEKSTEKGKGRAEPQQNVTPVSPTAPHGVNGGFMSRSRNGDEKQDLIPGDIKARMDELPPEITH
2) QKPASLSPSATQKSRPQGQQLRQHQTVTPNPSQQSQGRNNQSRREVVEID
1
1075
92
1124










Molecular Recognition Features






MoRF SequenceStartStop




NANANA