<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32442
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELFLMAVMPDADLERAQALLQGLSGMTAQRSLHRVMFYAGPPQPRGLAIKRLNPAPSQQRLWADLHQQMTRSSFILQARYAIKPEDLGQQQQQNQSQPLLNASIASGSIPGMLRWQDLPDPTSSSNAVGILRLTTQRKKIDIPELRNLPTLLAENNYQFKSEMIEESITFFNNGTEYALVRYHRLPGVVSAPTEQAPQGAPVPLTALPSWDELRSPGLCLDPSGQWLLFVRRHVVEDTSPEKMKKALELLDGAHTQLTGVFEFRAVDRRAHDTRIERPLNNMPAPLPQKIRA |
Length | 294 |
Position | Head |
Organism | Ophiostoma piceae (strain UAMH 11346) (Sap stain fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Ophiostoma.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.427 |
Instability index | 68.90 |
Isoelectric point | 9.06 |
Molecular weight | 33062.54 |
Publications | PubMed=23725015
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32442
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.20| 18| 21| 66| 83| 1
---------------------------------------------------------------------------
66- 83 (32.54/20.59) DL..HQQMTRSSFILQARYA
88- 107 (26.66/15.66) DLgqQQQQNQSQPLLNASIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 176.72| 55| 224| 9| 65| 2
---------------------------------------------------------------------------
9- 65 (94.81/69.76) VMPDADLERAQALLQGLSGmtAQRSLHRVM.FYAGPPQPRGLAIKR.LN..PAPSQQRLWA
236- 294 (81.91/53.61) VVEDTSPEKMKKALELLDG..AHTQLTGVFeFRAVDRRAHDTRIERpLNnmPAPLPQKIRA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.32| 15| 21| 108| 122| 3
---------------------------------------------------------------------------
108- 122 (29.97/15.69) SGSIPGMLR......WQDLPD
126- 146 (19.35/ 8.21) SSNAVGILRlttqrkKIDIPE
---------------------------------------------------------------------------
|