| Description | Uncharacterized protein |
| Sequence | MAPQRPGSLPNIHVPPIESVTASNTYTNGGLSTPQSSIYSEIKSTLALPDTTIAPKSPRLEQPQILTTDFYLDREGKYTADMLTRFRNLVMLANSQKSADDNGSKASREVAASEALAMEVETRALVRAAEDLLQLTREMKELWLFGPLREIGEGEGEGKMDEDSVKVGEMVEQILRKDAESSKSKLAG |
| Length | 188 |
| Position | Head |
| Organism | Glarea lozoyensis (strain ATCC 20868 / MF5171) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Helotiaceae> Glarea. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.492 |
| Instability index | 47.79 |
| Isoelectric point | 4.92 |
| Molecular weight | 20570.99 |
| Publications | PubMed=23688303 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP32440 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) IYSEIK 2) QILTTDFYLDR 3) SVKVGEMVEQILRKDAESS | 38 64 164 | 43 74 182 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab