<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32436
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAIAVDAWMNPSTTNFAGNLLASPPPPSPPPPSRKMATSYNSSAFAPAVPAQFKPNAASLYQTRFEVECEFVSCLANPYYLQHLAAEKYLDDPRFVLYLNYLLYWREPPYLQYLSWPGPSLRHLELLQDETFRQAIISPDVVLRLEHEGTESAFNWATTS |
Length | 160 |
Position | Middle |
Organism | Ophiostoma piceae (strain UAMH 11346) (Sap stain fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Ophiostoma.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.242 |
Instability index | 56.73 |
Isoelectric point | 5.08 |
Molecular weight | 18116.30 |
Publications | PubMed=23725015
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32436
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.45| 26| 27| 57| 82| 1
---------------------------------------------------------------------------
57- 82 (48.15/27.15) AASLY..QTRFEVECEFVSCLANPYYLQ
85- 112 (45.30/25.18) AAEKYldDPRFVLYLNYLLYWREPPYLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.25| 18| 21| 14| 31| 2
---------------------------------------------------------------------------
14- 31 (34.53/14.25) TNFAGNLLASPPPPSPPP
38- 55 (31.72/12.60) TSYNSSAFAPAVPAQFKP
---------------------------------------------------------------------------
|