<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32434
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSFHPQTPQSPSQSSPISSVGNSSNINNNGGGLSSSFASSTSAAHSIQLTQSNQATQGSQTTQSTLPTPAHSVNGSGFGSGSGALDSSADMSALLNDDSPHKRKRLLDDAGEHELKKVHMEGQQRLDFEALHQDVGEKYLVCKNSHQPSFPPLSEDLYSMFNLSGIAAEVARTLPNGEKNAMRKTYKGYMKKLGVSGHFEPIKREPGDESDFMALLAEPEDSWQARQVKTKDIRYGLLGDVEASLRAALTMNKGPLPKAVWDNSVLGSDVPPLGSGVGGVIRGSSAARGTAPNTPLHPAALARSKAQSQPAVGSPGGATGAGATDSSRPRRMNKKRSYNDNSFEGYNETFDEDGYSTGGDNGDGPSHKRRKKNDTPTTQYPPAPVRQQSYGPGMVGA |
| Length | 397 |
| Position | Head |
| Organism | Ophiostoma piceae (strain UAMH 11346) (Sap stain fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Ophiostoma.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.770 |
| Instability index | 54.24 |
| Isoelectric point | 7.84 |
| Molecular weight | 41998.72 |
| Publications | PubMed=23725015
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32434
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 142.27| 42| 78| 251| 295| 1
---------------------------------------------------------------------------
251- 295 (71.56/40.44) MNKgplPKAVWDNSVLGSD..VPPLGSGVGG.VIRGSSAARGTAPNTP
332- 376 (70.71/33.42) MNK...KRSYNDNSFEGYNetFDEDGYSTGGdNGDGPSHKRRKKNDTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.37| 21| 238| 63| 88| 2
---------------------------------------------------------------------------
63- 88 (30.04/20.43) QStlpTPAhsVNGSGFGSGSGALDSS
307- 327 (40.33/15.32) QS...QPA..VGSPGGATGAGATDSS
---------------------------------------------------------------------------
|