<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32431
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MDSAGTALGLELEDLKAIDTVRARLAQLTSSVQRLQGDVLMSNPLPPPESIQASAFVLQQNMASLNEVMTQHADLFRRIVVHPDPSFPGRTEEQVLTSLLRKKLEPDVEQMAERARDKAASRGISQTSFDVKKKAYGEDDDDEDDDDDEDDEDEDNEEEDDDDDMFEGARQPYGLGDIWYDARGWCISQITTFIQEEAAQNYTKQEREQGIETVRTGLRRRLDDDEEDEDDDDDDDDEDEDDDKMTDAQPPSHTKQPAQAPAQAPAPAPTAPPLEPELLLWFASRGDTNLPRYVDIESQRAAVLTGAQRRM |
Length | 311 |
Position | Head |
Organism | Ophiostoma piceae (strain UAMH 11346) (Sap stain fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Ophiostoma.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.989 |
Instability index | 59.40 |
Isoelectric point | 4.11 |
Molecular weight | 34969.43 |
Publications | PubMed=23725015
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32431
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.28| 11| 14| 138| 148| 1
---------------------------------------------------------------------------
138- 148 (24.73/ 8.55) EDDDDEDDDDD
154- 164 (22.39/ 7.14) EDNEEEDDDDD
233- 243 (24.16/ 8.21) DDDDDEDEDDD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.98| 16| 84| 109| 124| 3
---------------------------------------------------------------------------
93- 108 (22.16/16.32) EQVLTSLLRKKLEPDV
109- 124 (23.82/18.11) EQMAERARDKAASRGI
---------------------------------------------------------------------------
|