<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32430
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAAIKLDELQWSDPMVADEMQGIHSNSVLFYFMRSPYFDKTSNNNTIYNQALHNHTMFPVLETRERFEEFLKSMSGVEYIVHQAPAEMAPGTGTGVWVIRKQLRRKRNDGRPDDITVYADYFVVGYNIYQAPNLADILSSRITSMAVALGKAFPAMDSMLTWSPAKGHVYETDDEEDDDDEDDGSDSEDEGGDAMDVDRPAKAATTAKNNDDDNDSESDDDDDGAAINPKLAEESFTIHQMFGHEYMDEMPISGRPGDFHFNLAGGGKRALGADPANPGAANNKNNAIAKDTGSGKGTPVSGAATKDGKDAKAGAKTGTAAPTKPKRRKSKGPAAA |
| Length | 336 |
| Position | Head |
| Organism | Ophiostoma piceae (strain UAMH 11346) (Sap stain fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Ophiostoma.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.739 |
| Instability index | 41.20 |
| Isoelectric point | 4.72 |
| Molecular weight | 36412.61 |
| Publications | PubMed=23725015
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32430
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.51| 28| 39| 157| 184| 1
---------------------------------------------------------------------------
157- 184 (53.48/24.39) DSMLTWSPAKGHVYETDDEEDD....DDEDDG
193- 224 (45.03/19.61) DAMDVDRPAKAATTAKNNDDDNdsesDDDDDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.61| 18| 20| 278| 297| 2
---------------------------------------------------------------------------
278- 297 (24.63/21.10) P..GAAnNKNNAIAKdTGSGKG
299- 318 (26.98/13.25) PvsGAA.TKDGKDAK.AGAKTG
---------------------------------------------------------------------------
|