<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32428
| Description |
Serine threonine-protein kinase ssn3 |
| Sequence | MSHGSSGSGPNSGSGLRQGLKRIQSSFDDPTDRGIGYVSYQSKVRVTDKYRVIGFISSGTYGRVYKAVSRQGLPGEFAIKKFKPDKEGEQITYTGISQSAIREMALCSELSHSNVIRLVEIILEDKAIFMVFEYAEHDLLQIIHHHTQQPRHPIPPATIKSIMFQLLNGCQYLHTNWVLHRDLKPANIMVTSSGQVKIGDLGLARLFYKPLHSLYTGDKVVVTIWYRAPELLLGARHYTPAIDMWAIGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIIDIMGMPTKERWPLLANMPEYQHLMPMQPAGHHHGHSHHHLSPSTHGNLEKWYYTTISQGQTSAPIQSTNASQLASLGTDGYRLLAGLLEYDPEKRLTAEKALEHPFFTANDNIPLYNNCFEGIKTEYPHRRVSQEDNDIRTSSAPGTKRSGLQDDSLRQAKRLKE |
| Length | 450 |
| Position | Kinase |
| Organism | Ophiostoma piceae (strain UAMH 11346) (Sap stain fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Ophiostoma.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.469 |
| Instability index | 40.18 |
| Isoelectric point | 9.07 |
| Molecular weight | 50804.40 |
| Publications | PubMed=23725015
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32428
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.94| 25| 168| 133| 158| 3
---------------------------------------------------------------------------
133- 158 (44.96/25.85) EYaEHDL.LQIIHHHTQQPRHPIPPAT
304- 329 (46.98/23.41) EY.QHLMpMQPAGHHHGHSHHHLSPST
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.18| 18| 52| 1| 20| 5
---------------------------------------------------------------------------
1- 20 (29.77/26.61) MSHGSSGSGPNSGSglRQGL
56- 73 (32.42/21.36) ISSGTYGRVYKAVS..RQGL
---------------------------------------------------------------------------
|