<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32425
Description |
Uncharacterized protein |
Sequence | MAANYWASTQRNHWMIDRWSLAKSKEEDLKYVSEADYVKLRIWFCHLIQKLAKRLQLRQQVVATAFVYFKRFYLNNSIKATDPILVLVTCVYLATKIEECPIHIKMVTQEAKTVFQAEFGGFPYDSSKVAEFEFYLLEELEFYLIVWHPYRSLTQICNELGMRESGLQYAWFIVNDSYRTDVSLLYPPHLISLAAIYITVVLNHADFTPGSAGDQRDMKQWFADLNVDIKSVIEISQEILAIYEVWADWKEEKMLILYKELRSKS |
Length | 265 |
Position | Kinase |
Organism | Mucor circinelloides f. circinelloides (strain 1006PhL) (Mucormycosis agent) (Calyptromyces circinelloides) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Mucorineae> Mucoraceae> Mucor.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.062 |
Instability index | 49.28 |
Isoelectric point | 5.91 |
Molecular weight | 31216.71 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP32425
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.17| 11| 16| 73| 88| 1
---------------------------------------------------------------------------
73- 84 (15.45/21.23) YLNNSIKATdPI
92- 102 (20.72/ 8.57) YLATKIEEC.PI
---------------------------------------------------------------------------
|