<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32402
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHEIFLTALIEDKDFTSACAVLGGLTNMDPWQSIQRVLYFQGPQRPTGISNQSSIEKPIRNNNGFLWKELHQNLTRQSFILQTRYDVLKDRDMGANASPMDLDATQGILRWTDFPDPPRGQPLLTQRKKVELWDQKKLPSVMRDNNHIFKTETIEEVYRFYRDDIEFCLTRHYFLQPLEHYTPMESKQQATIPMASLPPWESLTPVDQQKRWFLQVKAHVVQDNKPDEIRKAQDQLLSVRRELDGVFEFRGIDRKVHDTRVMQQMQGVQQLPQKVMVGK |
Length | 279 |
Position | Head |
Organism | Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium fujikuroi species complex.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.682 |
Instability index | 55.77 |
Isoelectric point | 7.79 |
Molecular weight | 32780.09 |
Publications | PubMed=23825955
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32402
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 268.58| 67| 81| 99| 167| 1
---------------------------------------------------------------------------
27- 94 (86.77/43.82) ..NMDPWQSIQRVLYFQGPQRPTGISNQSsieKPIRnnngfLW.....................KELHQNLTRQSFILQTR.....YDVLKDRDMG
99- 167 (115.00/64.58) PMDLDATQGILRWTDFPDPPRGQPLLTQR...KKVE.....LW...................DQKKLPSVMRDNNHIFKTETIEevYRFYRDDIEF
183- 253 (66.82/31.90) PME.SKQQATIPMASLP.PWESLTPVDQQ...KR........WflqvkahvvqdnkpdeirkAQDQLLSVRRELDGVFEFRGID............
---------------------------------------------------------------------------
|