<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32401

Description Related to SRB8-DNA-directed RNA polymerase II holoenzyme and Srb10 CDK subcomplex subunit
SequenceMGAHPRPPQRSVSSSSLPVQRPPPQRSLSHQQQFMAAASPVRKDASFIDLTADAGDATPNRYHTTPRRGGSRLRLELSHNASSGSLPTSESPQSLTPSRIPNSDPFQAMVGSPADSASSTLMPMPTRRPVTSQPRFAPRITATGPAPTKKDVRPKPYTVEIPSVAPRYFSANRPETAVRNPVDPFSKGLNSGYADFFPWNGAHYEDEWSSEAITKGTWDKVNLNVPETSSAKLAIFPALKQKTGLNALSTIFMGVLTQRRHRGQINAPSTFKPPPRVTLTDTKREVWLKDLANPAISLRRLSRTIPHGIRGRTLLDQCLNKNVPAERAVWLAKCVGANEIRGLKRKGVNGAFVMGGELKWARDWTVFVEQFVDAVVAGFGENDWKNRVTYAIRLATNLYSEQLLDRDHYLDWVVSGIENSLQSRIPMWLLIAQIYWKDLLRSRKYGRRLVFALLSHLHVISNDPDKDLLVQLSSRLSALLGSLIRSNPESFINPGAWSTYKDTLHACLRSDDEQARKSLHAINSRNSALVVSSTASPPAGRSQLVKLLDAALKESSGNHLAAACWATSENKALIMRTVVEWATSFHRPGLAKVYAAARLIRQWSQFRVNPTTPILETLDNIAPNDKARKNLVYHLVTELVRTGHFSVSQYMQWTIARGGYHCAAEIDPVSGPCSSRLLVELPLHALSEKKRAERGNLLRRAGNYSVAEEEQDITNAIRVVKHVVGLPLLSNDPLSGRKPMSLKRLLQRIGGSSTAVRSSIGAHLRDELTGHFIMKGHSLSLTMFTAVRDIMETTEDYAMLSDILGACAKTADSDVLASVADTVHSNLQIFYAMDSADELFSSLTERLRMMNEEQRLVPRPLLAALDSLAQRMAGHEVIASQLRQELVQNDRNNAIDACSPVSDIVATPSHQAENNVAEEVEKTLSSGTRLDPPTMNKLFRMIIPALERGWEKEDDTRRVLATLLARIRVFDAHHFDKLMTDWTSHIRSISNRSPLSTLFPLLIITGCLTMPIIMGTASPPFATIQSLAPDSSRGPATYLQELLQLVIMPLPRGTGLVAEESYRFHTEQKCAKFEQSKGLLNLVRNALLEYSAVRNHVSGTEFPLGNIECQESLLETLRTLVLVDSSAVSNALGIKALPAEAVGLVRKVTTKLLIPGDSGDTQISFDHILQIANELTLPFCQLKLNLDLSLPQPSVNEGQDQSSSRFEIFARAMDRAIEAGNIMWTSLLPCLSDDITQHLKTQAQTGFLDLIPSSKAPEFVDTGSRQSLRMAENLLEVVEAIISGQAPPKMAQLSLGMVEKLTDLWEIVAAGPQERPNCHAAVLQHWLPAMLRFVNLHSLSSEPPSAPLPTASATRPPIPPVHDVRARIVLVLCGLLLELETQPPATVGSLVQQVFDIAILLVDALPEELRANYNIMLSHREKAATPQSAAARGMGAQYGIGPVVQERLSPFILRRWEVLSEPTPNVGENDTSLSLGLFEAIKLQ
Length1484
PositionKinase
OrganismGibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium> Fusarium fujikuroi species complex.
Aromaticity0.06
Grand average of hydropathy-0.199
Instability index51.11
Isoelectric point8.83
Molecular weight163549.38
Publications
PubMed=23825955

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
DNA-directed 5'-3' RNA polymerase activity	GO:0003899	IEA:UniProtKB-KW
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP32401
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     111.36|      33|      41|     986|    1025|       1
---------------------------------------------------------------------------
  993- 1025 (60.67/39.35)	SPLSTLFPLLIITGCLT...MPIIMGTA.....SPPFATIQ
 1028- 1068 (50.68/20.81)	APDSSRGPATYLQELLQlviMPLPRGTGlvaeeSYRFHTEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.26|      25|      41|     283|     323|       2
---------------------------------------------------------------------------
  283-  311 (35.17/48.24)	KREVWLKDLAnPAISLRRLSRtipHGIRG
  326-  350 (45.09/19.53)	ERAVWLAKCV.GANEIRGLKR...KGVNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     173.40|      47|     111|     483|     532|       3
---------------------------------------------------------------------------
  483-  532 (70.58/55.12)	LIRSnPESfiNPGAWSTYK........DTLHACLRSDDEQARKSL..HAINS..RNSALVVS
  534-  576 (57.49/33.99)	.....TAS..PPAGRSQLV........KLLDAALKESSGNHLAAA..CWATS..ENKALIMR
  599-  648 (45.33/25.30)	LIRQ..........WSQFRvnpttpilETLDNI..APNDKARKNLvyHLVTElvRTGHFSVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     173.60|      43|     111|      40|      84|       4
---------------------------------------------------------------------------
   40-   84 (69.35/42.80)	PVRKDAS..F...IDLTADAGDAT....P.....NRYHTTPR.RGGSRLrlELSHNASSG
   97-  144 (42.54/19.89)	PSRIPNSdpFqamVGSPADSASSTlmpmP.....TRRPVTSQpRFAPRI.......TATG
  147-  192 (61.72/32.44)	PTKKDVR..P...KPYTVEIPSVA....PryfsaNRPETAVR.NPVD....PFSKGLNSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.14|      30|     268|    1104|    1209|       5
---------------------------------------------------------------------------
 1074- 1103 (50.32/30.82)	EQSKGLLNLVRN.ALLEYSAVRNHVSGTEFP
 1108- 1138 (43.83/104.62)	ECQESLLETLRTlVLVDSSAVSNALGIKALP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.35|      29|     268|    1178|    1209|       6
---------------------------------------------------------------------------
 1178- 1209 (43.61/38.19)	PFCQLKLNLdLSLPQPSVneGQDQSSSRFEIF
 1450- 1478 (52.74/33.70)	PFILRRWEV.LSEPTPNV..GENDTSLSLGLF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.54|      26|     321|     377|     407|       7
---------------------------------------------------------------------------
  377-  404 (36.44/41.88)	AGFgENDWKNRVTYAIrLATNLYSEQLL
  415-  440 (47.10/29.69)	SGI.ENSLQSRIPMWL.LIAQIYWKDLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.36|      26|      42|     658|     683|       8
---------------------------------------------------------------------------
  658-  683 (47.80/39.50)	GGYHCAAEIDPVSGPCS.SRLLVELPL
  702-  728 (39.56/31.09)	GNYSVAEEEQDITNAIRvVKHVVGLPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      29.55|       9|     268|     460|     475|      10
---------------------------------------------------------------------------
  460-  475 (11.22/22.18)	ISNDPdkdllvqLSSR
  729-  737 (18.32/10.10)	LSNDP.......LSGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     162.76|      50|     352|     884|     951|      12
---------------------------------------------------------------------------
  899-  951 (82.88/67.03)	SPVSDIVATPSHQA...ENNVAEEVEKTLSSGTrldPPTMNKLFRMIIPALERGWE
 1254- 1306 (79.88/35.74)	SKAPEFVDTGSRQSlrmAENLLEVVEAIISGQA...PPKMAQLSLGMVEKLTDLWE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32401 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MGAHPRPPQRSVSSSSLPVQRPPPQRSLSHQQQFMAAASPVRKDASFIDLTADAGDATPNRYHTTPRRGGSRLRLELSHNASSGSLPTSESPQSLTPSRIPNSDPFQAMVGSPADSASSTLMPMPTRRPVTSQPRFAPRITATGPAPTKKDVRPKPY
1
157










Molecular Recognition Features






MoRF SequenceStartStop




NANANA