<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32395
| Description |
Related to RNA polymerase II holoenzyme/mediator subunit |
| Sequence | MGDRLTQLQDAVDQLATQFVACLHYVNKRHDLETLGPNDKVREVKDAPKEGMSEFMIHSKGNMLTSLIDSLPPDEFRAGMVELSQDLIVKEQQIEVLISSLPGLDNSEMDQERYIKELEEDLKIAEAQRQEAIKEKDQILSELDSVIRSIRRP |
| Length | 153 |
| Position | Middle |
| Organism | Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium fujikuroi species complex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.548 |
| Instability index | 56.43 |
| Isoelectric point | 4.67 |
| Molecular weight | 17476.64 |
| Publications | PubMed=23825955
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP32395
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 104.20| 29| 33| 62| 93| 1
---------------------------------------------------------------------------
46- 61 (19.20/ 7.64) ..................DAPKEGMSE....FMIHSKG
62- 93 (45.63/37.31) NMLtslIDSLPP......DEFRAGMVELSQDLIVKEQQ
95- 128 (39.37/24.46) EVL...ISSLPGldnsemDQERY.IKELEEDLKIAEAQ
---------------------------------------------------------------------------
|