Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSTQPAPPDATPNLLHVQFKNPEFLSYLSHLQSTGQVASTTTAKPDPNHPLTEHNVMSYFATSPFFDRRSNNEQIRMQNIANGIQALTGAMPAKQEEQELKRFTGLEFVLVHSRPPLCFVIQKRWRTSPTETTPLAAYYVVNDSIYQAPDLYSILATRLQSTVYGLKSSLETQRRAKPSFDSRRGHHGRFIVPDPPAESDPRSKRASTSEADEDDGTAEAEDEEEESDEDIEFEDVDDQPVTRASASQVKRARFD |
Length | 255 |
Position | Head |
Organism | Pseudozyma hubeiensis (strain SY62) (Yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Pseudozyma. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.786 |
Instability index | 70.02 |
Isoelectric point | 5.08 |
Molecular weight | 28686.27 |
Publications | PubMed=23814110 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32372 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.91| 22| 34| 2| 28| 1 --------------------------------------------------------------------------- 2- 28 (30.49/29.28) STQPAPPDatPNllHvQFKNPEFLSYL 39- 60 (43.41/23.30) STTTAKPD..PN..H.PLTEHNVMSYF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DEDIEFEDVDDQPVTRASASQVKRARFD 2) SKRAST | 228 203 | 255 208 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab