Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MADEQDEGIGSIFPVPPPFYRHFTTDNLARLKEFRENAQADGPTTETSEPATSGLQRILDLPPELRFLVPPEPSTDGKWRNFGGQYDLSDPLPSLNDLQLYPSGPDDDPSTIPSEWTLDRAFYLKRIAKSILLNFLELVGTLSINPDQFEDKTQDLRVLFINAHHLINQYRPHQARETLILMMEEQVDRTRAQVEGVRRMKGTIDGLLKEMVNDGPNAPRDVVNGDGEAISQEEEWKDEQRAIWQALDEELAV |
Length | 253 |
Position | Middle |
Organism | Coniosporium apollinis (strain CBS 100218) (Rock-inhabiting black yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetes incertae sedis> Coniosporium. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.642 |
Instability index | 42.53 |
Isoelectric point | 4.49 |
Molecular weight | 28752.74 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32356 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.67| 11| 18| 84| 94| 3 --------------------------------------------------------------------------- 84- 94 (21.06/11.01) GQYDLSDPLPS 104- 114 (21.60/11.47) GPDDDPSTIPS --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
NA | NA | NA |
MoRF Sequence | Start | Stop |
1) KWRNFGG 2) PFYRHFTTDNLARLKEFRE | 78 18 | 84 36 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab