<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32351
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDAILDTHFQRVEAALNTLVNSITSYNPSEKAADDLVAADDQLLQGLEQLATHQANHQRILHLRQTADALTAQAKSKLRSLADARKELINTPVSTFPASSKDVPFDELLSYAKRIAKFTLPPNYRPAPSPPKPSAPDATPKPPDDTQLANGTSGTPAVADSAIAAAPNPDPQADLPKDEGVALATLTREQRDWLDSMSHTPFVPWPSEAVIQRGGLMEIQRMLERGRDPAAVLPPEEQEAEERRRAEEEESRKREEEEEEGRRREAWAAQSARRGEGQGAVFGGLDLYDPEEDE |
| Length | 294 |
| Position | Middle |
| Organism | Coniosporium apollinis (strain CBS 100218) (Rock-inhabiting black yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetes incertae sedis> Coniosporium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.785 |
| Instability index | 65.28 |
| Isoelectric point | 4.75 |
| Molecular weight | 32322.33 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32351
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.65| 10| 37| 127| 136| 2
---------------------------------------------------------------------------
127- 136 (21.10/10.27) APSP.PKPSAP
166- 176 (16.55/ 6.44) APNPdPQADLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.97| 14| 15| 7| 20| 3
---------------------------------------------------------------------------
7- 20 (23.26/16.23) THFQRVEAALNTLV
24- 37 (23.71/16.69) TSYNPSEKAADDLV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.08| 13| 15| 39| 51| 5
---------------------------------------------------------------------------
39- 51 (21.24/14.66) ADDQLLQGLEQLA
55- 67 (22.84/16.26) ANHQRILHLRQTA
---------------------------------------------------------------------------
|