Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAEPQDSVPREEYYGGYSRFELELEFVQCLANPHYLNHLATQKLLDNPEFIAYLDYLQYFKEPKYVKYLVYPGPTLRALQLLQQEQFRKDILSPQLVMRMVEEGLKASERDRP |
Length | 113 |
Position | Middle |
Organism | Coniosporium apollinis (strain CBS 100218) (Rock-inhabiting black yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetes incertae sedis> Coniosporium. |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.572 |
Instability index | 54.85 |
Isoelectric point | 5.17 |
Molecular weight | 13463.24 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | DNA repair GO:0006281 IEA:EnsemblFungi meiotic gene conversion GO:0006311 IEA:EnsemblFungi meiotic sister chromatid segregation GO:0045144 IEA:EnsemblFungi regulation of transcription, DNA-templated GO:0006355 IEA:InterPro transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP32342 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.09| 20| 20| 58| 77| 1 --------------------------------------------------------------------------- 58- 77 (36.08/21.10) QYFKEPKYVKYLVYPGPTLR 80- 99 (33.01/18.79) QLLQQEQFRKDILSPQLVMR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSVPREEYYGGYS 2) YLVYP | 6 68 | 18 72 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab