Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSELPKMSDLARQPSPKSSPRGSRSPAYPRQDSSGTLKTTITLGKNPSVFHSGLFYLMKEPPDQSELTGSTNLMSYHGLEHSYNKFSGGKKLKEELSAFLPNLPGNLDVPGIQDNSSLRSLIEKPPITGKELHPLSGSMLSGFRLHPGPLPDQCRLFNQVNQKKKKHKKHKRELKDGPLQESQDNSGEGGPDHKKVKKGKRSDEERKKRKKEKRRKKEKDKEGKVTV |
Length | 227 |
Position | Head |
Organism | Capitella teleta (Polychaete worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Polychaeta> Sedentaria> Scolecida> Capitellidae> Capitella. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.221 |
Instability index | 63.71 |
Isoelectric point | 9.95 |
Molecular weight | 25442.74 |
Publications | PubMed=23254933 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32336 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 185.58| 38| 39| 135| 172| 1 --------------------------------------------------------------------------- 52- 94 (24.56/ 8.02) ..............SGlFYLM.KEP.PDQSELtgstnlmsyhglehsYNKFSGGKK....LKE 96- 133 (44.23/19.87) LSAFLpnL......PG..NLDvPG.IQDNSSL...............RSLI.EKPPITGKELH 135- 172 (69.41/35.03) LSGSM..L......SG.FRLH.PGPLPDQCRL...............FNQVNQKKKKHKKHKR 174- 214 (47.39/21.77) LKDGP..LqesqdnSG....E.GGPDHKKVKK...............GKRSDEERKKRKKEKR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GPDHKKVKKGKRSDEERKKRKKEKRRKKE 2) HKRELKDGPLQESQ | 190 170 | 218 183 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab