<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32332
| Description |
Uncharacterized protein |
| Sequence | MSQNTVAQRGNQGSSTQTKEAQLKVYQKRLRDDIKTMTDNFLEIIRLMKIEEESHVSRPSKCEQDQFELEVRAANIVRAGESLMKLVSEVKQFVILNDFRSVNESIMAQMHMYRHVQTECDTKLFALRDDMAADLFEMEEEYYSSVYK |
| Length | 148 |
| Position | Head |
| Organism | Capitella teleta (Polychaete worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Polychaeta>
Sedentaria> Scolecida> Capitellidae> Capitella.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.607 |
| Instability index | 56.14 |
| Isoelectric point | 5.29 |
| Molecular weight | 17342.52 |
| Publications | PubMed=23254933
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32332
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.53| 22| 98| 17| 44| 1
---------------------------------------------------------------------------
17- 44 (25.01/41.33) QTkEAQLKVYQkrLRDDiktMTDNFLEI
117- 138 (40.52/32.72) QT.ECDTKLFA..LRDD...MAADLFEM
---------------------------------------------------------------------------
|