<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32329
Description |
Uncharacterized protein |
Sequence | MADRLTQLQDAVNQMADHFCNAVGIMQQMAPPGQFAGFEKSVSKQAQVTSDEHAALFAQLIARTAKDIDVLIDSLPSEESTPELQMASLLQLEQDNQEAAQELQHAVDHGTLVLQSTQSAMHSIAQAQLDSQALETQDAFASVGPLPEEEMDGQSQYSDVTNDGCL |
Length | 166 |
Position | Middle |
Organism | Capitella teleta (Polychaete worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Polychaeta>
Sedentaria> Scolecida> Capitellidae> Capitella.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.337 |
Instability index | 53.43 |
Isoelectric point | 4.05 |
Molecular weight | 17943.60 |
Publications | PubMed=23254933
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32329
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.15| 16| 19| 83| 101| 2
---------------------------------------------------------------------------
83- 99 (23.54/17.49) ELQMA...SLLQLeQDNQEA
102- 120 (22.61/ 6.72) ELQHAvdhGTLVL.QSTQSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.74| 15| 16| 129| 143| 3
---------------------------------------------------------------------------
129- 143 (22.95/11.16) LDSQALETQDAFASV
146- 160 (25.79/13.23) LPEEEMDGQSQYSDV
---------------------------------------------------------------------------
|