<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32318
Description |
Mediator of RNA polymerase II transcription subunit 15 (Fragment) |
Sequence | VNPGSMNHAPSPAAGGATDDTAYMEKWKQLQKYIEPLKRMINRIVKDEDRKIDLNKMTNLLNILSDSSQRLPMQTLLKCEQALERLDLQSKTGGGVPSVPTPVTAVSKAPEAHICQPLYEAVAAQINNPLLNHTLQRTFGPAMQVLNGGIDYTPPAPKRLRTASPPKDENDIPDMIQGEIARLDGRFRVEWDPLHKRGSKTLRFLCKIDDNHLPSVPALCFTVPEQYPRVSPLCHTLFFSADGTAFLKRVKKLLRSQLESMSSTHSISSLLDAWVSLLFSSVGPFANCASSFPGNEHKKGECCD |
Length | 304 |
Position | Tail |
Organism | Capitella teleta (Polychaete worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Polychaeta>
Sedentaria> Scolecida> Capitellidae> Capitella.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.385 |
Instability index | 56.24 |
Isoelectric point | 8.57 |
Molecular weight | 33642.27 |
Publications | PubMed=23254933
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32318
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.91| 16| 16| 37| 52| 1
---------------------------------------------------------------------------
37- 52 (26.37/21.19) LKRMIN..RIVKDEDRKI
54- 71 (21.54/16.09) LNKMTNllNILSDSSQRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.75| 23| 116| 97| 119| 2
---------------------------------------------------------------------------
97- 119 (43.31/28.12) PSVPTPVTAV.SKAPE.AHICQPLY
214- 238 (36.45/22.55) PSVPALCFTVpEQYPRvSPLCHTLF
---------------------------------------------------------------------------
|