<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32316
Description |
Uncharacterized protein (Fragment) |
Sequence | MASSANTIVDDLEGAFHGCLACMTSQEHFNISDSDEVKTSVDQSIQKFLDVAKQMECYFLQQRTLLSIYKPEQIIKEDIQELRQEIAVKDALIERHHEKLTQWQSIITSR |
Length | 110 |
Position | Head |
Organism | Capitella teleta (Polychaete worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Polychaeta>
Sedentaria> Scolecida> Capitellidae> Capitella.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.391 |
Instability index | 59.60 |
Isoelectric point | 4.95 |
Molecular weight | 12687.22 |
Publications | PubMed=23254933
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32316
No repeats found
No repeats found
|