Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSAPRERIKQLEDVERDVTSSLQCAAQALAEMTKEKPNAKQIEASSTQFIKKLEGVEKTLVEQLQYLASYSTGQSHEGSSYARSKDLQMTNQRMFLVKRRLDDLQLLANERRLRNSSNTTQESASFHGHNAYHL |
Length | 134 |
Position | Head |
Organism | Capitella teleta (Polychaete worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Polychaeta> Sedentaria> Scolecida> Capitellidae> Capitella. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.831 |
Instability index | 56.19 |
Isoelectric point | 8.73 |
Molecular weight | 15273.95 |
Publications | PubMed=23254933 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32307 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.86| 19| 39| 8| 26| 1 --------------------------------------------------------------------------- 8- 26 (32.51/21.25) IKQLEDVERDVTSSLQCAA 50- 68 (31.35/20.30) IKKLEGVEKTLVEQLQYLA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MSAPRERIKQLED 2) TKEKPNAKQIEASSTQFIKKLEGVEKTLVEQLQYLASYSTGQSHEGSSYARSKDLQMTNQRMFLVKR | 1 33 | 13 99 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab