<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32301
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MRSNPVPLQEYLLQGSILEEHGDVLLNRLNGLCDPVETGPEKFYDHELVYTLRDPVPPPVVFRVRQAVEHPEAPWHLRFLGQPDVADKSRHTLVRSCIDVGCSSNVADFLFEMGFRLDHEYTVKGYLFRKGRMKVTVSKIFRVVQSGNPEHAEPLTKSYLVELSVVAPQGQDQIQDDMKGFAEHLKPLVMLEKIDHRRLQQM |
| Length | 202 |
| Position | Head |
| Organism | Capitella teleta (Polychaete worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Polychaeta>
Sedentaria> Scolecida> Capitellidae> Capitella.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.374 |
| Instability index | 44.91 |
| Isoelectric point | 6.13 |
| Molecular weight | 23185.37 |
| Publications | PubMed=23254933
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32301
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.70| 27| 30| 126| 155| 1
---------------------------------------------------------------------------
126- 155 (42.27/39.46) YLFrkgRMKVTVSKIFRVVQ...SGNPEHAEPL
159- 188 (41.43/29.23) YLV...ELSVVAPQGQDQIQddmKGFAEHLKPL
---------------------------------------------------------------------------
|