<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32295

Description Uncharacterized protein
SequenceMKRAVTLSSLLQIHNMVAVLEVISSLEKYPITKEALEETRLGRLINEVRKKTSNEELAKRAKKLLRNWQKLIEPVTPNEAVPRGLQNPPGSANGGAHNCKPEAPLPAVAGSKPISELKSRNDIQKLNSPKPEKLGNRKRKGEHRDGHQGPPPPKVSKVSHEILQNSSPPPTNGIGGSPESFPSPVDVNLHAGPESSRTELSENDKHNKIPVNAVKPHTSSPGLVKPSSTSSLLKTAVLQQHDKLEETTGSHQPKSPRCSSFSPRNVRHDTFARQHTTYSPKDSMPSPSQRSQFLDTAQVPSPPPSLMQPSTPPMPAKRLEFSQQSVSEVSQHWQEQQVPSDSQHRHTAGTLPQHTSPSCKTSSHPGESLMSHIGFSQDASKMDSDDAASGSDSKKKKRYRPRDYTVNLDGHVTEGGVKPVRLKERKLTFDPMTGQIKPLTPKDPLQVEIPALTEQHRTETEKQEQKPNLQSPFEQTNWKELSRNEIIQSYLNRQSSLLSSSGVQTPGAHYFMSEYLKQEESTRKEARKTHVLAPNSKPTDLPGVTREVTSDDLNRICEHNWPGVNGCYDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
Length601
PositionUnknown
OrganismGallus gallus (Chicken)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae> Phasianinae> Gallus.
Aromaticity0.04
Grand average of hydropathy-0.950
Instability index64.07
Isoelectric point9.03
Molecular weight66719.93
Publications
PubMed=15592404

Function

Annotated function 
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central

GO - Biological Process
positive regulation of gene expression	GO:0010628	IBA:GO_Central
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32295
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      70.58|      14|      15|     140|     153|       1
---------------------------------------------------------------------------
  140-  153 (28.64/15.08)	KGEHRDGHQGPPPP
  157-  170 (21.87/ 9.64)	KVSHEILQNSSPPP
  183-  196 (20.07/ 8.20)	SPVDVNLHAGPESS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      97.55|      21|      22|     251|     271|       2
---------------------------------------------------------------------------
  251-  271 (42.11/21.75)	HQPKSPRCSSFS.PRN..VRHDTF
  275-  293 (30.60/13.72)	HTTYSPKDSMPS.PS....QRSQF
  352-  375 (24.85/ 9.71)	PQHTSPSCKTSShPGEslMSHIGF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.67|      20|      22|     454|     473|       3
---------------------------------------------------------------------------
  436-  455 (27.54/12.07)	IKPLTPKDPLQVEIPALTEQ
  456-  475 (33.13/15.89)	HRTETEKQEQKPNLQSPFEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.11|      24|      24|      89|     112|       4
---------------------------------------------------------------------------
   73-   99 (35.28/15.91)	EPVTPNEAVPrGlqNPPGSANGGAHNC
  100-  123 (39.83/18.86)	KPEAPLPAVA.G..SKPISELKSRNDI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32295 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) RNWQKLIEPVTPNEAVPRGLQNPPGSANGGAHNCKPEAPLPAVAGSKPISELKSRNDIQKLNSPKPEKLGNRKRKGEHRDGHQGPPPPKVSKVSHEILQNSSPPPTNGIGGSPESFPSPVDVNLHAGPESSRTELSENDKHNKIPVNAVKPHTSSPGLVKPSSTSSLLKTAVLQQHDKLEETTGSHQPKSPRCSSFSPRNVRHDTFARQHTTYSPKDSMPSPSQRSQFLDTAQVPSPPPSLMQPSTPPMPAKRLEFSQQSVSEVSQHWQEQQVPSDSQHRHTAGTLPQHTSPSCKTSSHPGESLMSHIGFSQDASKMDSDDAASGSDSKKKKRYRPRDYTVNLDGHVTEGGVKPVRLKERKLTFDPMTGQIKPLTPKDPLQVEIPALTEQHRTETEKQEQKPNLQSPFEQTNW
79
491










Molecular Recognition Features






MoRF SequenceStartStop




1) IRDRLL
12
17