<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32282
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSNQSQNNETSQVCSLPLPPAQYINNYTDENIKRGRAPKPPPPINDSYSMFGNTFNADDTIIRPLEAQGIKRLYPQHFDRRRELRKLNHSLLVNFLDLLDLLVRCPESPRRAEKVEDLSLLFIHIHHLLNEFRPHQARETLRVMMDLQRRQRIEISQRFQKHLDKVMEMLQQALHTLPDTSDLDSKLIVPMEAFESMETSDPNFNEMDTNAILDKMMCDIVDQI |
Length | 224 |
Position | Middle |
Organism | Rhodnius prolixus (Triatomid bug) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Heteroptera> Panheteroptera>
Cimicomorpha> Reduviidae> Triatominae> Rhodnius.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.621 |
Instability index | 53.18 |
Isoelectric point | 5.76 |
Molecular weight | 26249.72 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32282
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.92| 11| 21| 17| 27| 1
---------------------------------------------------------------------------
17- 27 (22.43/12.73) PLPPAQYINNY
38- 48 (23.49/13.64) PKPPPPINDSY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.71| 18| 21| 167| 184| 2
---------------------------------------------------------------------------
167- 184 (30.70/16.25) MEMLQQALHTLPDTSDLD
191- 208 (32.01/17.18) MEAFESMETSDPNFNEMD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.65| 20| 26| 81| 102| 3
---------------------------------------------------------------------------
81- 102 (28.30/22.35) RRELRKLNHSLLvnFLDLLDLL
110- 129 (34.35/20.67) RRAEKVEDLSLL..FIHIHHLL
---------------------------------------------------------------------------
|