<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32280
| Description |
Cyclin C |
| Sequence | MAGNFWQSSHYQQWVLDKQDLIRERQYDLAVLTDEEYQKIFIFFSSIIQTLGEQLKLRMQVIATATVYFKRFYARNSLKCVDPLLLAPTCVFLASKVEEFGVISNSRLISTCQTVVKNKFSYAYTQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLLGDIGPDDQSLLALAWKVINDSLRTDVCLLYPPFQIAVGCLVIACVIQQRDLKLWFAELNVDSEKILEIIRYVHSLYELWKNHDEKKDIQALLAKMPKPKTQPTR |
| Length | 267 |
| Position | Kinase |
| Organism | Rhodnius prolixus (Triatomid bug) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Heteroptera> Panheteroptera>
Cimicomorpha> Reduviidae> Triatominae> Rhodnius.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.019 |
| Instability index | 43.62 |
| Isoelectric point | 6.44 |
| Molecular weight | 31224.99 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
kinase activity GO:0016301 IEA:UniProtKB-KW
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32280
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.37| 14| 25| 98| 113| 5
---------------------------------------------------------------------------
98- 113 (20.06/21.61) EEFGVISNSrlISTCQ
126- 139 (27.30/20.65) QEFPYRTNH..ILECE
---------------------------------------------------------------------------
|