| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MRNLRFEQELEFVQLLCNPDYIRWLFDEGYFENDNFKRFLEYLNYWKTDEYKIFLTYPTCLNILDILNREDVKDLLKDESFYVKLGSEQYYLWKDRKTKNIIEDLI |
| Length | 106 |
| Position | Middle |
| Organism | Nosema bombycis (strain CQ1 / CVCC 102059) (Microsporidian parasite) (Pebrine of silkworm) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Microsporidia> Nosematidae> Nosema. |
| Aromaticity | 0.19 |
| Grand average of hydropathy | -0.592 |
| Instability index | 51.26 |
| Isoelectric point | 4.68 |
| Molecular weight | 13306.00 |
| Publications | PubMed=23496955 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP32272
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.00| 28| 49| 4| 31| 2
---------------------------------------------------------------------------
4- 31 (51.51/23.59) LRFEQELEFVQLLCNPDYIRWLFDEGYF
55- 82 (47.49/21.37) LTYPTCLNILDILNREDVKDLLKDESFY
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DYIRWLFD 2) IIEDLI 3) SFYVKLGSEQYYLWKDR | 20 101 80 | 27 106 96 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab