<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32268
| Description |
Mediator of RNA polymerase II transcription subunit 25 (Fragment) |
| Sequence | AGCVHFPQSAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQHKMEQQR |
| Length | 62 |
| Position | Unknown |
| Organism | Anas platyrhynchos (Mallard) (Anas boschas) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae>
Anatinae> Anas.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.321 |
| Instability index | 54.80 |
| Isoelectric point | 9.70 |
| Molecular weight | 7144.31 |
| Publications | PubMed=23749191
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32268
No repeats found
No repeats found
|