| Description | Mediator of RNA polymerase II transcription subunit 25 (Fragment) |
| Sequence | AGCVHFPQSAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQHKMEQQR |
| Length | 62 |
| Position | Unknown |
| Organism | Anas platyrhynchos (Mallard) (Anas boschas) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae> Anatinae> Anas. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.321 |
| Instability index | 54.80 |
| Isoelectric point | 9.70 |
| Molecular weight | 7144.31 |
| Publications | PubMed=23749191 |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP32268 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) IRQVITNHKQVQQHKME 2) MGLIPYDQS | 43 29 | 59 37 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab