<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32260
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAQPGIHDVPGLGGYSRFELELEFVQCLANPVYLNFLAQQKTLDRPDFVAYLAYLQYFQQPQYARFLHHPGPTLRALQLLQQERFRQDILAPGLVDRLVIQGQRNAVPANKD |
Length | 112 |
Position | Middle |
Organism | Setosphaeria turcica (strain 28A) (Northern leaf blight fungus) (Exserohilum turcicum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae>
Exserohilum.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.260 |
Instability index | 49.85 |
Isoelectric point | 6.82 |
Molecular weight | 12866.59 |
Publications | PubMed=23236275
PubMed=23357949
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32260
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.84| 17| 19| 55| 71| 1
---------------------------------------------------------------------------
34- 47 (22.57/ 9.17) LNFLAQ...QKTLDRPD
55- 71 (32.93/15.99) LQYFQQPQYARFLHHPG
77- 93 (28.33/12.96) LQLLQQERFRQDILAPG
---------------------------------------------------------------------------
|