Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEFIADQLKMQGVFQDWQYEQLYPSSGDNNSATTSATQQQTITTNAASIDHQNYLFRFLRSILLSYISLLGIMAADPTSEQKDQKLKDMMTMVANMHALINEYRPHQARQTLIERMEEQVRRKRAEVEGVRKMADKVREVLGSFGAVDGDDKAEHADAGRDENGVGKQQARKMDAQRDGWETLDEVLG |
Length | 188 |
Position | Middle |
Organism | Setosphaeria turcica (strain 28A) (Northern leaf blight fungus) (Exserohilum turcicum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Exserohilum. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.721 |
Instability index | 35.28 |
Isoelectric point | 5.15 |
Molecular weight | 21358.69 |
Publications | PubMed=23236275 PubMed=23357949 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32255 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 90.88| 28| 43| 115| 142| 1 --------------------------------------------------------------------------- 115- 142 (46.04/26.71) RMEEQVRRKRA.EVEGVRKMADKVREVLG 160- 188 (44.84/25.86) RDENGVGKQQArKMDAQRDGWETLDEVLG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GVGKQQARKMDAQRDGWETLDEVLG 2) MEFIADQLKMQGVFQDWQYEQLY | 164 1 | 188 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab