<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32218
| Description |
Uncharacterized protein |
| Sequence | MASNFWTSTHYKELKDPEEINVVNPIDAQRGISVEDFRLIKLHMSNYISKLAQHIKIRQRVVATAVTYMRRVYTRKSLTEYEPQLVAPTCLYLACKAEESVIHAKLIVFYIKKLYADEKFRYEIKDILEMEMKILEALNFYLVVFHPYRSLPEFLQDSGINDTSMTHLTWGLVNDTYRMDLILIHPPFLITLACIYIASVHKEKDIRTWFEELSVDMNIVKNIAMEILDFYENHRLFTEERVHAAFNKLATNS |
| Length | 253 |
| Position | Kinase |
| Organism | Capsella rubella |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Capsella.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.099 |
| Instability index | 43.04 |
| Isoelectric point | 6.37 |
| Molecular weight | 29835.32 |
| Publications | PubMed=23749190
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32218
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.07| 21| 101| 83| 103| 1
---------------------------------------------------------------------------
83- 103 (38.11/26.24) PQLVAPTCLYLACKAEESVIH
187- 207 (36.96/25.26) PFLITLACIYIASVHKEKDIR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.22| 16| 39| 66| 82| 3
---------------------------------------------------------------------------
66- 82 (23.87/18.93) VTYMRRVYTRKSLtEYE
108- 123 (28.35/17.58) VFYIKKLYADEKF.RYE
---------------------------------------------------------------------------
|