<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32218
Description |
Uncharacterized protein |
Sequence | MASNFWTSTHYKELKDPEEINVVNPIDAQRGISVEDFRLIKLHMSNYISKLAQHIKIRQRVVATAVTYMRRVYTRKSLTEYEPQLVAPTCLYLACKAEESVIHAKLIVFYIKKLYADEKFRYEIKDILEMEMKILEALNFYLVVFHPYRSLPEFLQDSGINDTSMTHLTWGLVNDTYRMDLILIHPPFLITLACIYIASVHKEKDIRTWFEELSVDMNIVKNIAMEILDFYENHRLFTEERVHAAFNKLATNS |
Length | 253 |
Position | Kinase |
Organism | Capsella rubella |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Capsella.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.099 |
Instability index | 43.04 |
Isoelectric point | 6.37 |
Molecular weight | 29835.32 |
Publications | PubMed=23749190
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32218
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.07| 21| 101| 83| 103| 1
---------------------------------------------------------------------------
83- 103 (38.11/26.24) PQLVAPTCLYLACKAEESVIH
187- 207 (36.96/25.26) PFLITLACIYIASVHKEKDIR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.22| 16| 39| 66| 82| 3
---------------------------------------------------------------------------
66- 82 (23.87/18.93) VTYMRRVYTRKSLtEYE
108- 123 (28.35/17.58) VFYIKKLYADEKF.RYE
---------------------------------------------------------------------------
|